PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN05661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 325aa    MW: 36512.1 Da    PI: 6.8701
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN05661.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.5e-101181551954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  KHN05661.1 118 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 155
                 665569******************************87 PP

2BELL60.15.3e-201433072
        BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                +q+v+ sFe v+gl sa+pY+slAlk iS+hFrcLk+ai++q+
  KHN05661.1  1 MQMVVQSFESVVGLSSATPYVSLALKSISKHFRCLKNAISDQL 43
                9***************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.9E-15140IPR006563POX domain
PROSITE profilePS5007111.98596159IPR001356Homeobox domain
CDDcd000867.87E-1299160No hitNo description
SMARTSM003892.4E-899163IPR001356Homeobox domain
SuperFamilySSF466892.14E-17101165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28102163IPR009057Homeodomain-like
PfamPF059201.2E-18116155IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MQMVVQSFES VVGLSSATPY VSLALKSISK HFRCLKNAIS DQLKLTCEVL GEDYSIPTTS  60
TGSKFDNNVA RLRCMDQNFQ KNKSGGANIN FLEPQQHVWR PQRGLPERSV AILKAWLFEH  120
FLHPYPTDTD KHMLATQTGL SRNQVSNWFI NARVRVWKPM VEEIHMLETK GATEAHQHQT  180
SSKNDQLASA SEGSNNQLKS DNQPAHEFGA HALHSHAIPE KQFQCLEMGS SSLAGNEEQH  240
MGMEEDQWSQ EKRSKLECQI ASTPSMDGTV MGFMPYRRSG LEGLGSVSLT LGLRHGVEGV  300
QQQHLQQEEE LRRQFGGHMI HDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15105163563Homeobox protein Meis2
3k2a_B2e-15105163563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540761.10.0PREDICTED: BEL1-like homeodomain protein 8
RefseqXP_006592271.10.0PREDICTED: BEL1-like homeodomain protein 8
TrEMBLA0A0B2P8Y70.0A0A0B2P8Y7_GLYSO; BEL1-like homeodomain protein 8
TrEMBLK7LTM00.0K7LTM0_SOYBN; Uncharacterized protein
STRINGGLYMA12G08270.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.35e-62BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]